DPCstruct | MC11305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372QNL2 | 89-244 | LLDNSFSQKLNCFGRLINLKDLHIGNTNEGRIKQGIYNHFYGSLKPLKNTIKIENLSINNTDIDSGLEYLPDSIKIFQCSADKRPEA… |
| A0A372RXD6 | 1-142 | MDNNKFPAQDLSCFTPFINLERLYIVNNPFYGSLKPLRDLTYLKEIGIAGTDIDSGLEYLSENFFNLDAVASNLGLVGGHFKRLLIC… |
| A0A397FVR9 | 115-281 | None |
| A0A397FQS3 | 105-238 | None |
| A0A397FNB5 | 491-633 | None |
| A0A2I1GRM2 | 117-297 | None |
| A0A0H1S8I9 | 96-231 | None |
| U9UL87 | 210-377 | None |
| A0A2N1M867 | 718-840 | None |
| A0A372RJ30 | 846-997 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.