DPCstruct | MC11304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833W4B3 | 61-150 | HSTATLGDLLPGARMSEETRRISVKLVPSRVVRCAEAFGSLTPQLISNKFNQQEKYDWTSSGCIAVNGDGGAGVDIFFALNDAVTDN… |
| A0A507CZT6 | 87-178 | HKELLVSDILRGTRFKSAVFQTRVHIRVAKVFRSNEQYGPDIPRTITQHGAGYNAVDWTEGQYLQVVLNGDGGPGVDIFFALKRKND… |
| A0A177WX00 | 156-256 | None |
| A0A2Z6RQU9 | 122-220 | None |
| A0A177WXV4 | 28-122 | None |
| A0A833T2S9 | 448-550 | None |
| A0A2N1MTL1 | 443-535 | None |
| A0A015JR45 | 308-394 | None |
| A0A433PZZ3 | 26-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.