DPCstruct | MC11303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 149 ± 32 aa |
| Standard deviation of domain lengths | 31.56 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1CIK8 | 1-123 | MDDQYKWTLSTGKVVEDALYDFGVACKHEHLAHQFIVDPFNKQMESIFDEAELQEIRSANVKPMPMMPMPLRNYIASFNKKNTNEIR… |
| A0A372RSY7 | 21-178 | SISEDDDSDYIPSDAENQNPPSLLFSSQLKEFQESYVKMDVAQKWFLSSGKCVEDTIYEHCKQLPVETYLHSWIIDLDDEETEMLFN… |
| A0A372QK71 | 304-455 | None |
| A0A372Q9L1 | 1-121 | None |
| A0A168N209 | 191-308 | None |
| A0A168HFH8 | 103-279 | None |
| A0A168HFG3 | 45-264 | None |
| A0A162R5I6 | 21-185 | None |
| A0A0B7NJI6 | 31-207 | None |
| A0A0B7NFQ8 | 69-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.