DPCstruct | MC11301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 207 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397FSR9 | 73-272 | YDHTHWQFRHVVMWLEKYIEVLSYYPDWPQRKQLDNSSIKRKDVNDPQKIERTFPTMLGFLRLLVYNPPWLLNELKEEFYKWINATG… |
| A0A372RSA5 | 20-239 | QATAHSKRCMIDILSNTLESVEAFTEKIDPSFQSRRQIRGKSLQDENGIAEDYRHTAMTQCSSLLGIIVSTKFPEVKAYAQKEFYMW… |
| A0A0H1S6M3 | 22-244 | None |
| A0A397FVI1 | 2-216 | None |
| A0A397FQE2 | 2-199 | None |
| A0A2N1NMU2 | 14-239 | None |
| A0A397TVH5 | 144-356 | None |
| A0A0T7SBN0 | 4-209 | None |
| A0A0T7SB55 | 15-179 | None |
| A0A2Z6S8U4 | 9-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.