DPCstruct | MC113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 134 ± 13 aa |
| Standard deviation of domain lengths | 13.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0433 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538PGW6 | 1-115 | MTAIARDAVASDHLVYAWPFPIGPDEYEVACSEDELVVMCPSWMVGDRLGPGRHRWRTPDPMRPVAAFFVLTAPVEVSFDMTTMFVI… |
| A0A7J4YHW9 | 1-128 | MAIIKSIYWEQNNQEELVYKFPFNNVTLGSVLTVNESQEAFFFKSGTLYDSFTAGRHTLSSANLPLLEKLINLPSGGDTTFTAEVWF… |
| A0A143X8Y7 | 131-261 | None |
| A0A7C5NAX8 | 1-131 | None |
| A0A843DCN7 | 17-152 | None |
| A0A521U996 | 6-152 | None |
| A0A1V6DS95 | 64-184 | None |
| A0A087DNF2 | 8-135 | None |
| T0NBM8 | 14-154 | None |
| A0A2N0LRP0 | 34-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.