DPCstruct | MC11299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401LE97 | 1-94 | MGTFLSDIVLQVLSFVAENERSNIRQRQAEGIAAAKARGVKFGRPPKPLPENFHTVYQRWKNGKITGTKAAEECNMPITTFRYKADI… |
| A0A1H6LKI3 | 27-110 | MINAILIEVLGAIAENERNKIRARQREGIAAAKKKNVRFGRPPKSLPDNWQQIMADVRCGNKKPVEAIRELGISRSYFYKLYSD |
| U6SLV2 | 1-90 | None |
| B1V632 | 37-126 | None |
| A0A1I0G5I8 | 5-77 | None |
| A0A6N9PSV3 | 45-131 | None |
| A0A3G9JSM0 | 99-183 | None |
| A0A140DTH4 | 2-82 | None |
| A0A658JVI3 | 86-173 | None |
| A0A7U9T7I8 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.