DPCstruct | MC11297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3QAP3 | 2-131 | ASAASLAVRMAQVLLEYGNGSIPENTNFFQPLAEPLIRVPSLPSITFSIGRKGKSFFDYYDFYLFGIRHDFLFNTNRNVTTARWDEI… |
| A0A7M3PY87 | 362-486 | TAAGLAMRLTQLNVEAGGGKLDPTKGLFAPMRGQDVYVPITPEITFHFENYGTNEIRGLYDMFIFSLNLDASSARQNVSEMTFEEIF… |
| A0A3P7M344 | 197-322 | None |
| A0A3P6SLS2 | 242-357 | None |
| A0A3P6QQ36 | 4-160 | None |
| A0A3P6QGF3 | 6-134 | None |
| A0A3P6QDE6 | 85-216 | None |
| A0A5K3FWD7 | 69-222 | None |
| A0A3P7Q278 | 88-216 | None |
| A0A3P7MDK2 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.