DPCstruct | MC11295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452T966 | 2-122 | EQEVGPPLLTPISEDLEIQNIPPWTTRLSSNLVPQYAIAVLRSNLWPGAYAFSNGKKFENVYIGWGHKYSPDNYTPPALPPVYQEYP… |
| A0A7M3Q8D0 | 28-174 | GLCLCSWQWINVIQKDESDSEDSEASSKAEEIDLPEPETGPPLLTPIAEDQDPSGIPPWSAKLTSSRLPQFAMAVLSSNLWPGAYAI… |
| A0A310SUH3 | 380-503 | None |
| A0A815AX64 | 176-300 | None |
| A0A7I0ZKK2 | 807-913 | None |
| A0A0R3TAK1 | 15-158 | None |
| A0A1I8HMT7 | 1036-1167 | None |
| A0A815P5R4 | 956-1075 | None |
| A0A7S0HE87 | 2-140 | None |
| A0A5K3F024 | 2-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.