DPCstruct | MC11292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 324 ± 46 aa |
| Standard deviation of domain lengths | 46.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.88 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0023- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E2Y652 | 8-358 | MPQEQITSSLRQQIFLDPQTQEWQPADEYLSGNVRAKLDIARAAAQSDPDFAVNVQMLERVQPEPLTAADINVKLGTIWIPPEDIDH… |
| A0A7T8ZWM5 | 303-666 | NAYVLLLEKEELEFPSGELQQMVENGAFEVPANPYHDAVRKAAAREFVGSSMAIAQNVEALERVQPKDLTAPEISVKLGTTWIDTQD… |
| A0A8A4I3Z9 | 302-703 | None |
| A0A809NDE2 | 40-393 | None |
| A0A7Y4U8H4 | 548-887 | None |
| A0A510WSN3 | 290-640 | None |
| A0A7X2MA06 | 801-1151 | None |
| A0A0M3I3Q5 | 288-591 | None |
| D4WGF2 | 491-849 | None |
| A0A6D2C1Q0 | 259-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.