DPCstruct | MC11291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 249 ± 37 aa |
| Standard deviation of domain lengths | 36.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226QKR8 | 2-215 | TILPYILQDFNENGVYNNCQDELKIEFTDIIHAAITVGRRNWDDVLYHGIYSDYEVNFRTSLVQTFLTDNGNSRYLTVSGPYHTLDP… |
| A0A4R8YQF1 | 2-264 | PNVSYSVELFPHPYDHLNTLRIDHPCSGLDLFRFAVANKLQTASFSDRWSRSPTRAVFDSAVEPALFVYSNVTTSIGRLSVHQNFRV… |
| A0A6I4PI02 | 7-229 | None |
| U3ADN7 | 92-328 | None |
| A0A5A7VXE6 | 3-248 | None |
| A0A356TQQ7 | 10-315 | None |
| A0A2T0JZM4 | 59-307 | None |
| A0A4R1WWE0 | 4-240 | None |
| A0A357XCA2 | 108-368 | None |
| A0A328ZLA5 | 37-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.