DPCstruct | MC11290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 14.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7Q7C3 | 2-91 | VDALPLPGTDAFAEYGGATINIYTTEESEDGALAIAAREVARAGWQIQSVEDNYLLAREDLVDSPDGLQYFEQTLIDGIVLVVYTYP… |
| A0A0A2HWZ0 | 39-142 | HMTEYPLFYQFEVRPTARNSEVEMLAGALATVLVFAETEEVGRARGARFIARQHWEIISVKRVMRMCSRHVSDLQPHFRELYRQAEQ… |
| F6IKF2 | 82-177 | None |
| A0A831KBU0 | 3-105 | None |
| A0A1B8NY92 | 2-110 | None |
| A0A2Z3HC11 | 63-174 | None |
| N8Y7W7 | 1-106 | None |
| A0A450TNM7 | 2-111 | None |
| A0A6A8BDD2 | 124-237 | None |
| A0A518RII4 | 14-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.