DPCstruct | MC11289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Standard deviation of domain lengths | 15.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2HWF2 | 6-143 | AGKQRGKPFKPGQSGNPAGKPPGVKNRATVLAQALFDGEAESLTRKIIELAKAGDMQALKVCIDRLCPPIKAQSAPIQVEIPVTDSM… |
| A0A2N8T612 | 2-108 | RALIEPHKAEIIAKAVELAKAGDPQSLRLCLERLAPAPRPEAEKVVVPGLADAPTLQAKATAILAAVAGGQISAEAGDKLLRMLDTY… |
| A0A1I0PXT7 | 22-161 | None |
| A0A1G9PRA2 | 49-162 | None |
| A0A4P6FKR4 | 13-129 | None |
| A0A4P6FGX3 | 1-131 | None |
| A0A437K110 | 13-141 | None |
| A0A2N0V8L5 | 1-133 | None |
| A0A1I3TNJ5 | 1-106 | None |
| A0A2S5T7E9 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.