DPCstruct | MC11288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Standard deviation of domain lengths | 12.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3IV18 | 104-185 | EMTYHRVKFSAKSRPDDQDDVILAVNGEVLITARDREVILPGSFLEASDHGTYPRFEQLPNLPRKILGRVQAFPYTYLGAAT |
| A0A0A2HQY5 | 13-109 | DVPPAVKERKPPKNAAQKPETKVRIMIDEVSGLSNYEVVAVNGKVYQIKRGVPVEVPPEVVHVLENAQMTILEQRKNPLTGLTEEVP… |
| A0A1N6QZ33 | 5-90 | None |
| A0A068YQ10 | 29-123 | None |
| G1UY53 | 26-129 | None |
| A0A6M3KT95 | 15-119 | None |
| A0A6M3L605 | 57-175 | None |
| A0A7C1NS55 | 157-243 | None |
| A0A6I1KIH3 | 56-150 | None |
| A0A1E7I7M5 | 57-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.