DPCstruct | MC11282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 288 ± 33 aa |
| Standard deviation of domain lengths | 33.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0LE56 | 3-239 | FVDTMINLMENELHGRVLGWRPNDIIVGRFTDNINNYQLGVLEAIRFTTLRLKDSLTRMGDADTYDPDLEYALNLFMIRATSFWFPT… |
| A0A7Y8MBI3 | 32-336 | TGWRLTRKVLLGAAVFVVLWYGVGMWVVHRIDDDPAFTFSQLDHESGGSRAVGIATALVRREVRVHDWVSNDPWFMPGVLNDNMQHY… |
| A0A7G5IM03 | 26-296 | None |
| A0A1G8TFV9 | 28-337 | None |
| A0A1H3Z7Y5 | 931-1266 | None |
| A0A7C1AJP4 | 92-341 | None |
| A0A3B9VJ73 | 14-256 | None |
| A0A6P1ZJL6 | 95-411 | None |
| A0A846HU47 | 42-356 | None |
| A0A1J4X2K9 | 1-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.