DPCstruct | MC1128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 165 ± 17 aa |
| Standard deviation of domain lengths | 17.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452ZZX5 | 23-168 | RSCAYFPEYRLGAFGTIPLLMGNRLSSEDYAVLGVRYGSENLSIGASFVPLPESAEVPYGAWLVGRKGSLCAGAQYKPLSGNKHPMP… |
| A0A067LAC5 | 1-146 | MRSCAYYPRYGFGAFGIFPLLLSKRTSSEDYGVMGLRYGSENLSFGTTFMPFAVKNELLMSAWAVSKMGRLTVGAQYEPQYGSKDVA… |
| A0A835MQZ0 | 266-447 | None |
| A0A061EBT7 | 2-151 | None |
| A0A453A003 | 1-163 | None |
| A0A452ZZY9 | 87-258 | None |
| A0A452ZZY7 | 4-149 | None |
| A0A452ZZX4 | 36-182 | None |
| A0A2P2KR25 | 5-151 | None |
| A0A835PKM7 | 104-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.