DPCstruct | MC11277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 99 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9EZL3 | 12-101 | PTILTFTNTTSCDQGTVAAGETQKFLPLCRFCCAHGYCPQPCICTGYGEESSLPPVTGVQACRIQGTEKANDELCAFACAHGYCPSE… |
| A0A2P5HJP9 | 138-216 | QTCVQGWGEGNFDDLCRFTCKYGYCPSGACICTNFGKALDQPKSTGIVGYPGNGDDNYGGLCTFACNLGYCPPTACATE |
| A0A2V1DQ76 | 192-271 | None |
| A0A5N5N7X7 | 545-628 | None |
| A0A0C3GUV5 | 142-256 | None |
| A0A395ISQ1 | 328-448 | None |
| A0A5N5NHR8 | 98-189 | None |
| A0A3D8T2Y4 | 529-644 | None |
| A0A3D8QA89 | 258-360 | None |
| A0A2V1DA37 | 297-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.