DPCstruct | MC11275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 185 ± 16 aa |
| Standard deviation of domain lengths | 15.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9P0I2 | 71-264 | ISHVPAHLTKALYIPKHDDTISHFAIYDISKEYSEKVGVNPMGSERYKVELCLLRKPSGHHVGDNARFLVDIDASVSIRERVMGRDP… |
| A0A4U9EUB9 | 12-171 | PSHLTKVLYFPRHNEEVSHFPIYEISEQYFDKIGKLPMGSRDYKVELCLLRKPNGEFLGDNARFLVDVGDDSTSMSVRERILGQDPV… |
| A0A0A2L0Y6 | 167-361 | None |
| A0A423XHY9 | 52-265 | None |
| A0A151GUY4 | 31-209 | None |
| A0A1B8AVC8 | 1-181 | None |
| A0A4R8QDW6 | 37-205 | None |
| A0A5N7EVJ4 | 1-189 | None |
| A0A0K8L892 | 1-201 | None |
| A0A5N6I2R2 | 3-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.