DPCstruct | MC11274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 214 ± 21 aa |
| Standard deviation of domain lengths | 21.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9NZG6 | 13-228 | DIRKEYRLTGRDGDVVASILETRPPRCIAPVKTCGFSCIVTVLRRINSHMMLAPNGVLNSQSWRQAEANNPFISHSWQMFGPERDTR… |
| A0A4U9ETP1 | 1-222 | MDIRTMYDTKGQELSVACHILECRYSTITRKNSLPGFDCLIVVLRLIYGTFMFENGGSCHWIGAAETKNHFLRHAWSPFGPEEREVR… |
| A0A179HU15 | 8-240 | None |
| A0A366P0D9 | 5-210 | None |
| A0A0P7BIM6 | 5-250 | None |
| A0A1L7W0E6 | 7-190 | None |
| A0A1G4B7J3 | 26-194 | None |
| A0A063C707 | 6-240 | None |
| A0A395N5D9 | 12-218 | None |
| C7Z3P5 | 190-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.