DPCstruct | MC11271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 104 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259RAT4 | 51-147 | APAAEAATIAGPGKMGNSTKGKRAQPLSAEIETAKREATNPDDAYSVYAVLQRWADERKAPFLGLVKGVGCKYLTPDGKFEIFTPAA… |
| A0A0K6I9W8 | 193-289 | APAGEVATIAGPGTVRHNTKGKRAQPLDAEIEAAKHEATNPNDAHAVYAVLQRWAEERKAPFIGFAEGEGIKYQTPAGEVDFFRFDA… |
| A0A2N4TZ43 | 292-404 | None |
| A0A0Q4PBE3 | 124-222 | None |
| A0A843BH16 | 186-288 | None |
| A0A1I6Y3Z2 | 100-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.