DPCstruct | MC1127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 136 ± 18 aa |
| Standard deviation of domain lengths | 18.27 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 63.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251SQ23 | 1-126 | MDPPQSQSQPPPPSSSSADNHHQLSKKKDRHSKVNGRGRRVRVPALCAARIFQLTRELGHRTDGQTIDWLLHHVDPSLFPSSFAGAP… |
| A0A067L6F4 | 14-130 | SPSNKKPKSISPKTSKTKLINAKQRKDRHSKVNGRDRRIRLPAVCAARIFQLTRELGNRTDGETIEWLLKMAEPSIIAATGTGISAT… |
| A0A2C9W024 | 4-148 | None |
| K7MKW1 | 60-224 | None |
| A0A287RZ16 | 144-273 | None |
| A0A218X406 | 64-215 | None |
| A0A0A9DEW8 | 16-157 | None |
| A0A022QZQ5 | 58-183 | None |
| A0A6I9S5W3 | 31-164 | None |
| A0A2U1QPI9 | 25-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.