DPCstruct | MC11268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 186 ± 22 aa |
| Standard deviation of domain lengths | 21.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0SSW3 | 26-233 | IGDAKTLGLAGAIVSFVIWVITFVASLISELIGILLAFVGIVGIILVYLGISKISEAVNDAKIKNSYLIYFILSIVSLAIATIGTII… |
| A0A161KJ78 | 5-187 | KVEGIRTLLVIGTLTMLLSFLPVVGLALAVVGGLLYLYALYRWGEEVDGRPFKLAIINLILGIVGAGVAIVGLIKISSATSELYVLD… |
| A0A7J3JAR3 | 1-211 | None |
| A0A698BU98 | 59-250 | None |
| A3MVK1 | 3-181 | None |
| A0A4P9DXA4 | 3-164 | None |
| A0A7J2YWF2 | 31-244 | None |
| A0A7C5L6C0 | 11-160 | None |
| A0A7C4GL03 | 1-171 | None |
| A0A537HG03 | 4-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.