DPCstruct | MC11265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 5.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A140PSS6 | 1-99 | MEELSRQFKAGEINEKQLKEAARDIVKGYGKDIGIDYEVVYLDESTMPKDAKGSTGSAYILDEKNRKVLIPIDVNKIKDTGDLFGTI… |
| A0A0M5M6L8 | 2-99 | EELSRQFKAGEINENQLKEAARDIIKGYGKDIGIDFEVVYLDEETMPKDAKESTGSAYILDEKNRKVLVLIDVNKIKDTGDLFGTIA… |
| F9EQE3 | 49-142 | None |
| D6LGH7 | 49-142 | None |
| F9EQ06 | 87-180 | None |
| A0A0K9CN14 | 331-428 | None |
| A0A2D3PAR6 | 49-143 | None |
| A0A510KAS1 | 22-110 | None |
| A0A2G9F9I2 | 1-80 | None |
| A0A2G9EGH5 | 44-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.