DPCstruct | MC11260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 286 ± 46 aa |
| Standard deviation of domain lengths | 45.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318WR20 | 63-337 | VDLAALRPAPEDLGRLLFTEFTLNYGNDFYWLPIDVPTGSLARVESLRVTTSFGDVIDVASTAETDAREGRVAPGDTPWTMFTPTRL… |
| A0A264Y8K4 | 72-392 | WEFEDHMVYMGDSKDMQSQGNIVMMQYATMYSNDWMIMPLTVEVGDYIEVKELTVWDTFGVKSTIKNQKNSQQGVTDDVKWQMFTHT… |
| A0A4Q3NVG4 | 99-393 | None |
| A0A1Q7VUG8 | 46-264 | None |
| A0A6F8XX93 | 3-215 | None |
| A0A317K611 | 12-258 | None |
| A0A6A2FFA3 | 255-620 | None |
| A0A418QL37 | 256-605 | None |
| A0A4Z1CDW7 | 38-272 | None |
| A0A4V1BII8 | 207-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.