DPCstruct | MC1126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 177 ± 33 aa |
| Standard deviation of domain lengths | 32.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 66.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L8L1Z1 | 1-198 | MRTFFSILITLMLLSGCGNLVSQKRADLLLENKNDMSGQLLTLPAQLRVVYLRVKADKTYVSFAEPGPDAALSDTFKLIAGATQDVT… |
| A0A504JEU9 | 6-188 | VIVIILILITSVACSPAINVRNTNARSGIMRVKQFTNKPTTLMWAHHDPTQRQTLMYVDENGNIKILAEQSPDAGLSRNLNLTTKAK… |
| A0A850SVF0 | 22-173 | None |
| A0A5C7RGC2 | 13-250 | None |
| A0A3A4RNZ7 | 7-163 | None |
| A0A1G7BWA1 | 18-195 | None |
| A0A370MY42 | 1-177 | None |
| A0A2U0SX75 | 29-174 | None |
| A0A1M4VTM8 | 1-172 | None |
| A0A1V9GB29 | 2-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.