DPCstruct | MC11257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 71.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5BE20 | 467-524 | MDELGIRPNVSIVSMVGDVFQKLGMLDKYEKLKKKYAPPKREYRYIKGKRVRIRSKHL |
| A0A3P6EVF4 | 35-91 | MEELGVKPNISIVNMVGKVFLKLGMEDKYEKLVKKYPPPQWEFRYIKGRRVKVKAKQ |
| A0A7J8U0G3 | 1-66 | None |
| A0A804QVI1 | 135-203 | None |
| A0A2G3CWM6 | 20-76 | None |
| B6T067 | 1-57 | None |
| A0A804PED6 | 181-243 | None |
| A0A7J8R5V0 | 1-68 | None |
| A0A843VNV4 | 53-118 | None |
| A0A816R6Q3 | 186-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.