DPCstruct | MC11255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 6.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7TJZ9 | 2-79 | QTHKNASLRSEPVIQKEAKKAGPVVPPDYQKNDAPRIYWDGKVWKVDFQFGNKNALVEVKDKKESIYIYKCTDSVIKI |
| A0A427B1C9 | 7-95 | LLGLRKVTDDMKTKKRADRTGVIVATDKSPRANSFSFSRAPPKLELQMGRKWAVENQIGKRNLAIDDCDSKQSVYIYGCKDSVLQVK… |
| A0A2G9Q8G7 | 1-103 | None |
| A0A2P5WJM0 | 172-262 | None |
| A0A6J5VS59 | 616-706 | None |
| A9V0Y7 | 566-663 | None |
| A0A6A6MUX4 | 263-354 | None |
| A0A2P6TFE4 | 724-818 | None |
| A0A251V4T2 | 304-393 | None |
| A0A2P6VQ58 | 320-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.