DPCstruct | MC11253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 262 ± 23 aa |
| Standard deviation of domain lengths | 23.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1LXU9 | 2-253 | FKSVVVLYEGEKMLGNVDVSFTPENFRVLRHKISGKVVVSHLSKPSERCSPLAVLHTITSSGNGRRNGVCLKMECRDTSNHWMHFLY… |
| A0A2I0J6C2 | 7-246 | KCVVYHGETCLGELDAIPVSDQGFQFPGNEIRIHHISPHSERCPPLSVLQTISSFSVRCKLESSFPGEQSHLINLHASCFYECKTAV… |
| A0A453FYQ1 | 11-256 | None |
| A0A4S8J5T3 | 1-318 | None |
| Q5N890 | 1-270 | None |
| A0A540L471 | 7-246 | None |
| A0A2P6V3X3 | 1-269 | None |
| A0A2C9U4Q6 | 3-260 | None |
| A0A833QFQ2 | 3-244 | None |
| A0A7S3QXX6 | 2-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.