DPCstruct | MC1125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A071LTP0 | 3-81 | KITAYAWASGLIEFGTVTPDGALPILSGEETRVRGLIEDMARHSRNSDQLLVPGIPEAPRQHEGLDALIKFTDLIQRQY |
| A0A6L8L1H0 | 5-95 | LQPQAAWCWASGVIEFGAETEVPEDSILIAYGPKAHLFNEVSIMARRGRGASEGLLLVPGVPEAANQRAGADALAKWLEWCAKGNGR… |
| A0A5S9R7U4 | 135-216 | None |
| Q2WA66 | 4-90 | None |
| A0A084ZCI1 | 28-107 | None |
| A0A024KIZ9 | 92-174 | None |
| A0A431UFU0 | 2-86 | None |
| A0A7J0BXP8 | 11-88 | None |
| A0A3D4TIZ5 | 2-85 | None |
| A0A1Y1J2A8 | 49-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.