DPCstruct | MC11248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182GLX4 | 6-102 | TRLIRSGIIFPLNEGTEVEQLEQLVKKDSIIRQEYIDVLKLKPRDTKIVHYLPHVFADESLIGYNYNGVNVVGQTKRAMRMHDIFSN… |
| A0A182F2H5 | 25-127 | DGDADDGDDVAEPPAARCLEGVRFPIETVEQLDQLERLVQTCEIARDRYIRLLRRLKTPNTSLSETYQQLFADRLLIHYNYDGISPK… |
| A0A182JNL3 | 33-151 | None |
| A0A182J6I0 | 120-225 | None |
| Q17CC7 | 18-138 | None |
| Q17CD1 | 32-150 | None |
| Q17CB9 | 348-443 | None |
| Q17CB1 | 247-337 | None |
| A0A084WSR8 | 49-157 | None |
| A0A182F8L6 | 35-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.