DPCstruct | MC11246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 150 ± 13 aa |
| Standard deviation of domain lengths | 12.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3TX75 | 1-140 | MWAANNLLSRGFKNKAIKFLDDNLPKELAYTKNIILANCELEKGNEKGWLDYFNKYLEYFNISKLLLKDDREEGMISRFYTEGRFED… |
| X7F4H6 | 178-317 | GHLAVAEMLARHLAGAPAEEVAAAYAVAVTLGADGAETDLVRGNTEADPAARLAWINRALARFALPPLALEPGPGPAFDRLRAAATP… |
| A0A6B3RP45 | 132-282 | None |
| A0A7U7ZJK7 | 6-140 | None |
| A0A6P0NRN3 | 443-617 | None |
| A0A1U9JYR5 | 229-368 | None |
| G2E5W5 | 197-353 | None |
| A0A3M6QLS9 | 751-898 | None |
| A0A2E5QDJ0 | 725-876 | None |
| A0A2V4DR97 | 331-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.