DPCstruct | MC11245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 306 ± 45 aa |
| Standard deviation of domain lengths | 45.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9FAB5 | 2-251 | RRSVSTLLLWLASLLFGAAMTGWWMQQTVFDPSNTESVTDAVLDHESVRTELTRRITEATAEQLGVDRDEVAFAVDRAAQTPAGAEL… |
| A0A2N3G1A5 | 4-301 | FRTLVSALSIFLGALAIALWALGWAALYAVEDGAVFKGVAERSYDNPAFKAAITDEAQSGVRNYFERQGVNVEALRLGGALDALVVV… |
| A0A0R2FRN5 | 17-284 | None |
| D3PZZ3 | 16-317 | None |
| A0A1H5MDH8 | 219-557 | None |
| A0A7L7M690 | 22-425 | None |
| A0A7X1PCT6 | 1-306 | None |
| A0A3A0AVM6 | 19-242 | None |
| A0A3C1DJF4 | 1-256 | None |
| A0A7C1FWD0 | 3-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.