DPCstruct | MC11243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A427CEY6 | 1-102 | MATDQSLDPLWNVHAFERDSISYFQISDIAEGLLFIIAKSGDVFWLLPAGTIDTQVALPSDHQPQRPTLDAKEVFRHPDFTLLVSGT… |
| A0A839ZS84 | 178-269 | ATDLSAVSTLHVYTFERDGIRYLQVNGPSGDVRTAIGWIDGTRWVMPVGIDADRTTILAAGSRPSGTVVYEGDGMTVLLQTLPRGNS… |
| A0A2J0TD27 | 65-162 | None |
| A0A0G9HDA8 | 26-126 | None |
| A0A1B2MZI3 | 29-118 | None |
| A0A7W5HJ91 | 38-139 | None |
| A0A7W6KR52 | 3-84 | None |
| A0A2N7QNU7 | 36-141 | None |
| A0A1I6MMJ5 | 41-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.