DPCstruct | MC11241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5NMD0 | 1-67 | MVTDSAVYIGNHDWVGSEFAYNAGTGLVIKPTQTLKERGATILEQVKAVFERDWQSRYAKTLQASNR |
| A0A443RXX4 | 46-105 | MVTEKHAYIGTSNWSADYFVNTGGVGFVANTTDTRNNIRTQLERVFTRDWFSIYATFLHN |
| A0A672KJA8 | 1-66 | None |
| A0A667GA96 | 1-68 | None |
| A0A161MI00 | 1-60 | None |
| A0A5B7HZ30 | 46-123 | None |
| A0A6A4RI74 | 58-115 | None |
| A0A151MM67 | 94-156 | None |
| A0A4W5LRR5 | 32-97 | None |
| A0A2A2JBB5 | 165-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.