DPCstruct | MC1124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 211 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9LZK9 | 5-211 | TRIIKNTRIERQHRGDVFVVLMMIVNDMSIVNESLREWSETTEKRRVGRKHGARAFFVRVQMADVYEALLLIEIIRKDEALKAEIAK… |
| A0A532F5N1 | 21-239 | AFEGDENVPQRLCNLVLALALIYNDCKNTTYAALLLKDCKPAGKPKINAVWGTWAGTDWHLFRLMISAVHELFILIQDHQDVLTHEF… |
| A0A2L0WDR7 | 4-201 | None |
| A0A1I4FK41 | 24-222 | None |
| A0A7U5CUI8 | 1-230 | None |
| A0A2V6IP77 | 5-198 | None |
| A0A1F9GIL0 | 71-280 | None |
| A0A532EH80 | 3-200 | None |
| A0A1G4Z7X9 | 14-254 | None |
| A0A494XXT8 | 2-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.