DPCstruct | MC11239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 4.14 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 58.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673MDD8 | 93-168 | RKPYCLELYNPNSRGQKIKACKTETDGRVVEGKHQSYTICAASAEERDDWIESIRASITKDPFYDLVSIRKKKVIN |
| A0A4W5NIS7 | 1-76 | NCFELFIPENKDQVIKACKTEADGRVVEGNHTFYRISAPTTEEKDEWMNSIKAAISRDPFYEMLATRKKKVSSMKR |
| A0A4C1TW83 | 289-360 | None |
| A0A2G9SCS0 | 25-98 | None |
| A0A498M5E2 | 758-836 | None |
| A0A6P8UGE0 | 200-273 | None |
| A0A6I9Z0C3 | 246-323 | None |
| A0A151N1W1 | 437-510 | None |
| U3KCK3 | 339-407 | None |
| V9IJM5 | 123-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.