DPCstruct | MC11238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 8.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 62.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 49.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673ART7 | 2-88 | LPPLRRAKRCTCYTYKDKECVYYCHLDIIWINTPEHTVPYGISSYQGSLRMKRSAGIGRGRGGSEAQRCVCALRSDTECSSFCTDRR |
| A0A4W5NHA5 | 1-101 | MEEDTAASTTATPVPVRHIRNKRCSCATFLDKECVYFCHLDIIWVNTPERVVSYGLGNASRKKRAIKDPAISKQDPRCKCVHEDDST… |
| A0A3Q0T5F2 | 1-93 | None |
| A0A3B3BQ64 | 29-125 | None |
| A0A667Z325 | 55-148 | None |
| A0A6P7IMM6 | 40-143 | None |
| A0A6J1YCY8 | 67-176 | None |
| A0A3B3I2F2 | 34-136 | None |
| A0A3P9KX63 | 36-135 | None |
| A0A4W4FPM6 | 11-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.