DPCstruct | MC11236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 87 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1MBH2 | 40-125 | DPSLAKLIHFQGYPSELLPVTVRGIPSAHICLDSLPELMQQPSVTKQIFAIQLLSQLSLQYALPKSLNICVTALNLLYALLGAISP |
| A0A672T533 | 774-860 | YWLFISAYRGYPQALLPLTVAGIPSMHICLDFIPELLAQPQLEKQIFAIQLLSHLCTQYALPKSLSVARLAISVMGTILTVLTRAKR |
| A0A3P7EFB2 | 417-502 | None |
| A0A7R9B1S8 | 272-348 | None |
| A0A3Q0KPJ6 | 1233-1320 | None |
| A0A6L5DE97 | 18-99 | None |
| A0A7J7KN79 | 37-129 | None |
| A0A6M2DZM7 | 153-242 | None |
| A0A4W5NJ38 | 1-90 | None |
| A0A3R7LSY6 | 226-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.