DPCstruct | MC11234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 121 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183ENJ6 | 2-103 | AWMLEGWEKDECYAKYGVDGTICSFRVYLSEVEKHCPMLPWRSRTQQNLPKQKRASVQRNLSKLFMLMYDSEVNYVFIRERITRLWP… |
| A0A4W5N5A4 | 1-127 | MSKYLLNGAQEKCELPPMDGFPHCEGKVKWMKDMWRSDSCYTNYGVDGSTCSFFIYLSEVENWCPRLPWRTKTLDEEADRRGQTEIR… |
| A0A0N4XGW7 | 15-137 | None |
| A0A4W5RPZ4 | 1-155 | None |
| H3AJR5 | 2-116 | None |
| A0A3P6QVN6 | 667-802 | None |
| A0A0N4XGL1 | 22-127 | None |
| A0A1S3R9K7 | 3-143 | None |
| A0A7M3REN9 | 250-382 | None |
| A0A3P9Q208 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.