DPCstruct | MC11233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7G810 | 56-167 | RKMKPLKELFQSSSELPWVFLTAALIAGNWGAYIYAVNSENVLQASLGYYINPLLNVVLGILFLGEKLTKHQKIAFTSALTGVVILT… |
| A0A063YTM5 | 1-123 | MAPSAGSFGRCAVGRLRQRGIAAAAVLISANWFVYIWAVNHHHVVETSLGYYINPLVSVALGTIVLRERLSVGQWAAVFLAAAGVAA… |
| A0A6A5AZE6 | 1-93 | None |
| A0A7R8N4L5 | 74-172 | None |
| A0A6N8KBV2 | 20-118 | None |
| W7BHQ8 | 36-155 | None |
| A0A397F3N0 | 372-508 | None |
| A0A380E008 | 16-124 | None |
| A0A3R7YX49 | 56-168 | None |
| A0A0S6WTL1 | 43-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.