DPCstruct | MC11232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 194 |
|---|---|
| Mean domain length (aa) | 118 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.99 |
| Pfam Score | 63.89 |
| Assigned Pfam label(s) | PF11807- PF03951- PF06209- CL0286- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2QTE6 | 4-113 | LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGNNILV… |
| A0A063YPU1 | 6-117 | VSSTQTELLEQIKEKIKEKNVELLHLQFVDIEGILKHVTVTAEQLDDVVEGKIMFDGSSIKGFSPINRSDLYLLPDLNTFAVLPWTV… |
| A0A2H3C3J4 | 15-146 | None |
| A0A446IT65 | 164-291 | None |
| A0A0H2M766 | 472-602 | None |
| A0A4Y7L0F7 | 128-268 | None |
| U6KMD9 | 41-154 | None |
| A0A7M5X9Z2 | 19-155 | None |
| A0A815T6D4 | 314-440 | None |
| A0A7J9KQK4 | 30-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.