DPCstruct | MC11231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 210 ± 27 aa |
| Standard deviation of domain lengths | 26.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.49 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF07477- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4L7W0 | 167-389 | QANWYVYGRMAWNPDATAKDIAEEWIRQTFSNDPAFLEPVITLMMNSRQNLVNYMEPLGLVHIMNSDHHYGPGPWVNNLSQANWNPV… |
| A0A063YLY4 | 13-216 | AWNPDLSAEEIANEWVVQTFGDDSRVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDR… |
| A0A2Z5Z757 | 2-152 | None |
| A0A139LK90 | 456-660 | None |
| A0A7C7VX22 | 2-160 | None |
| A0A7X6QM16 | 396-660 | None |
| A0A7S3F6G1 | 2-186 | None |
| A0A7V8VQ84 | 80-305 | None |
| A0A484G0J1 | 414-631 | None |
| V4NX52 | 36-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.