DPCstruct | MC11230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 100 ± 16 aa |
| Standard deviation of domain lengths | 16.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673GPE0 | 7-104 | SNPPNIKYEQSDMNSIARLVKWSYHEGDLKSGAPYPPCTGMHRRAVCVYGAGDLKWIVQQHHLLANKFDPEVDEVAIKCMEAFLRYK… |
| A0A2K5SJD7 | 16-105 | CGVPGSMPNASWTGNLRAIKWNDMEDKHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSET… |
| T1EE18 | 260-366 | None |
| H3A0C1 | 25-116 | None |
| A0A0R3U9H5 | 35-114 | None |
| A0A0K0EIW0 | 409-551 | None |
| A0A819Y516 | 78-173 | None |
| R7TX60 | 72-177 | None |
| A0A368FDD7 | 58-164 | None |
| A0A3P6QMU9 | 19-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.