DPCstruct | MC1123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6CH91 | 1-96 | MEVRLNIDDATPQELARGIAAAEAVFERAGIMALQGAEGLFALEGWDFKGFPEDDKPTEDEDRTATVWMEADKAAVTACCAGWSEVP… |
| A0A1I4EUH2 | 2-98 | DIRISVPGASPEEIERGLAAARAVFDEAGISPMRAAEASFAVEGWDEAGFPDDDRYPDDEDFALVHVWGEADEAAAVACCRDWPEEK… |
| A0A2N2RUR6 | 16-111 | None |
| A0A4R6GX51 | 21-114 | None |
| A0A502SDT7 | 1-96 | None |
| A0A522L9T4 | 178-272 | None |
| A0A7R7C2Q9 | 4-100 | None |
| A0A562C9I0 | 1-110 | None |
| A0A2N5B2S9 | 2-114 | None |
| A0A848JPW4 | 135-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.