DPCstruct | MC11229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 266 ± 37 aa |
| Standard deviation of domain lengths | 36.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.12 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF12145- PF09497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5SJA0 | 1-244 | SVPSLEQDELTAVNVKQGFNNQPAFTGDEHGSARNIVINPSKIGAYFSSILAEKLKLNTFQDTGRKKPQVNAKDNYWLVTPRSQSVI… |
| A0A6H0XX18 | 148-372 | IIPPAMATKLVHPRAVADFVPWRGNHPEDILNEQTVKTGYTEGPSPNQNESNTARLTIWPTLSQKNNVALHTLSLLYTQVLEKRQAL… |
| B3RM14 | 24-236 | None |
| A0A7R9HTP9 | 155-451 | None |
| A0A182E6F6 | 17-235 | None |
| K7KC24 | 72-342 | None |
| A0A482WZV6 | 9-245 | None |
| A0A6J1X5J1 | 33-313 | None |
| A0A317BL80 | 74-359 | None |
| A0A183M5C6 | 1-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.