DPCstruct | MC11228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 7.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8YK43 | 2-73 | KIPEMQNLIKISNIPDDAYSINRKPQDESLCIQKNANIWEVFYYERGLKNSVHTFKNEDEACEYFIKKLNEW |
| A0A433SGF6 | 11-80 | KSRLLQLREELRSLSVPDNHYSLGHVLDERTCLIERNGAWLVFYSERGRMEDLHTFSSFDEARKFILMIL |
| A0A6H1NY07 | 1-83 | None |
| A0A542EG26 | 1-88 | None |
| A0A3D5DUM0 | 257-328 | None |
| A0A7X3MKX9 | 20-96 | None |
| A0A316R6J1 | 85-152 | None |
| A0A1H7XWV1 | 4-88 | None |
| F2G896 | 45-116 | None |
| A0A4S8QQF9 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.