DPCstruct | MC11224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2DCV9 | 11-102 | IAGFLKSILVIILLVSILSFLSLPVQNSISRTFERQADNFALQVTEDPDIHISLMGGLANSNLSNVSPHWYIRYFLYSHTTIMERTE… |
| A0A7J8ACB5 | 94-170 | QFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAEDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLIERLQAL |
| Q2HB93 | 236-311 | None |
| A0A7V0S0S8 | 10-100 | None |
| A0A838HVK7 | 13-103 | None |
| A0A4U5M107 | 124-203 | None |
| A0A368FAF9 | 3-65 | None |
| A0A7J6PIX3 | 346-427 | None |
| A0A7V2V7U5 | 22-116 | None |
| A0A7J6U771 | 277-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.