DPCstruct | MC11223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 120 ± 21 aa |
| Standard deviation of domain lengths | 20.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF09163- CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A285B6U7 | 1-93 | MKTLAGERVAELKTRGYDNAGLYDPAGVGGTHVMYVLHHADKPNLYHGLPENPEISATVKFWKGIWKPLAAVGFAATFAASIFHYVG… |
| A0A7V6YGH1 | 2-112 | GMPPACAKTCPPGALQFGPRDKMVAMAEARVQQLKSTFPRAQTYGIQEMGVGGTHMIYVLQDAPEVYGLPANPQVPLSLYIWKDVVQ… |
| A0A238WIX8 | 124-246 | None |
| A0A1Q6ZH27 | 80-209 | None |
| A0A7W0YNA9 | 1-88 | None |
| A0A7C1YRH4 | 48-161 | None |
| A0A022PE43 | 104-209 | None |
| A0A2N6AM92 | 178-300 | None |
| A0A1Y0BAU9 | 2-124 | None |
| A0A011QUP7 | 5-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.