DPCstruct | MC11221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 205 ± 17 aa |
| Standard deviation of domain lengths | 17.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559RBK5 | 10-213 | LIIASSFSYSQTQTTEIEAKGIFSEIAVEKQNLAVERILGKDKKEKKAIIETVKENPNDFNPPVLYALSHELFEQGNNDEACYWFYL… |
| A0A6S6FZN2 | 143-340 | TALDQVLPGFAGSYSFVGNEFSGMSPNEAQLEIMQRGSVAQRAAARRFIVAHPGDVHPSALIQVISELVALGDFERAAFWYYVWQIR… |
| A0A1Q8JQ46 | 394-589 | None |
| A0A075K9G8 | 97-288 | None |
| A0A839VRK5 | 67-278 | None |
| A0A2E6QE97 | 1-225 | None |
| A0A2D9XPT1 | 1-236 | None |
| A0A1X3RRC8 | 101-288 | None |
| A0A2N2C562 | 41-230 | None |
| A0A1Q4BHL2 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.