DPCstruct | MC11220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 129 ± 14 aa |
| Standard deviation of domain lengths | 14.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7KFG4 | 1-117 | MILLPTGYTYGRLGTRQSVEAVLAAGRGEVQLEGLRGRSCWESAGQVAEIAVREQVSAGASDLTVDESGTLPVVRHRDGRAWAVELS… |
| A0A521C9M5 | 1-121 | MLVLPHGLFCGRVDQAEDPADIVTAYTEERVDERYLRGRSSRSAAVQGAQHHARAVVPDDRIDAFAPVSVVERNEHVEVTLEGPGGP… |
| A0A0M4QPA5 | 153-271 | None |
| A0A842GW16 | 1-162 | None |
| A0A2W5SVD4 | 208-368 | None |
| A0A4V2QXE8 | 87-208 | None |
| A0A5D4FHL8 | 250-387 | None |
| A0A7W1ZF47 | 70-189 | None |
| C7QCX7 | 208-334 | None |
| A0A7K0KR54 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.