DPCstruct | MC1122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 67.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 92.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2P3X7 | 283-385 | NSKKKISPKLIGDAGEYVTSLLFGKRSTRYLSNQRKLDANFNTHSFNHTIPDFLVSINGIPSLVEVKNVQVQSLTEQISFELKLARE… |
| A0A825HVD0 | 1-102 | NKNINSKDIGDAGEYAASMLFTKRSTRYLSNRRKIDANFNTHSFNHTIPDFLVTLNDYPTLVEVKNVQDQALTEQISFELKLAREYE… |
| A0A7U9VFW5 | 1-116 | None |
| A0A824D906 | 119-225 | None |
| A0A5Z1F7X4 | 95-205 | None |
| A0A6W1WSH1 | 94-209 | None |
| A0A825XZE3 | 249-363 | None |
| A0A825LPU7 | 146-261 | None |
| A0A825EAC6 | 177-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.